Description
Ellington, A. D. et al. reported aptamers with affinity for bFGF in their article published in 1998. The ps11-20 aptamer was named by Ellington, A. D. et al. in the article[1].
SELEX
In their work published in 1998, Ellington, A. D. et al. used SELEX to isolate RNA aptamer sequences with affinity for bFGF from a nucleic acid library containing about 5×1012 sequences after 11 rounds of selection process. Human recombinant bFGF was purified from yeast expressing artificial bFGF cDNA[1].
Structure
The 2D structure of the figure is based on the prediction results of the RNA fold website by ribodraw tool to draw. The figure shows the secondary structure prediction of the original aptamer sequence. This aptamer contains three stem loops of different lengths. The two stem loops closer to the 3' end are connected by a long junction[1].
5'-GGGAAUGGAUCCACAUCUACGAAUUCAAUCCCAAUGGCUUGAACUGCCAACGAACGUUCACUGCAGACUUGACGAAGCUU-3'
Ligand information
SELEX ligand
Growth factor actives in angiogenesis, and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. Growth factor may functions in angiogenesis of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Growth factor binds and activates KDR/VEGFR2 and FLT4/VEGFR3 receptors. It acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4, and as an integrin ligand which is required for FGF2 signaling.-----From Uniprot
UniProt ID: uniquely identifies protein sequences in the UniProt database, a resource for protein information.
Pfam: a widely recognised database of protein families and domains.
GenBank: maintained by NCBI(National Center for Biotechnology Information), is a database of nucleotide sequences from various organisms, vital for genetic and molecular biology research.
Mass: an intrinsic property of a body.
| Name | Uniprot ID | Pfam | Mass | Protein sequence | PDB ID | GenBank |
|---|---|---|---|---|---|---|
| bFGF (basic fibroblast growth factor) | P09038 | PF00167 | 30.77 kDa |
......
MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
|
1BAS | 2247 |
Some isolated sequences bind to the affinity of the protein[1].
| Name | Sequence | Ligand | Affinity |
|---|---|---|---|
| ps11-20 aptamer | 5'-GGGAAUGGAUCCACAUCUACGAAUUCAAUCCCAAUGGCUUGAACUGCCAACGAACGUUCACUGCAGACUUGACGAAGCUU-3' | bFGF | 1.8 ± 0.8 nM |
Similar compound(s)
We used the Dail server website to compare the structural similarities of ligand proteins, and chose the top 10 in terms of similarity for presentation.
Dail server website: a network service for comparing protein structures in 3D. Dali compares them against those in the Protein Data Bank (PDB).
Z-score: a standard score that is converted from an original score. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious.
RMSD: (Root Mean Square Deviation) is used to measure the degree to which atoms deviate from the alignment position.
PDB: PDB ID+ chain name.
| PDB | Z-socre | RMSD (Å) | Description |
|---|---|---|---|
| 1BAS-A | 30.6 | 0 | Original chain |
| 1G82-A | 23.7 | 1.1 | Fibroblast growth factor 9 |
| 3A07-B | 18.2 | 1.5 | Actinohivin |
| 1UPS-A | 17.6 | 1.9 | Glcnac-alpha-1,4-gal-releasing endo-beta- |
| 2VSE-A | 17.3 | 1.7 | Mosquitocidal toxin |
| 6LF2-B | 17.1 | 1.8 | Sevil |
| 8BAD-B | 16.8 | 1.8 | Binary toxin a-like protein |
| 1W3A-A | 16.7 | 1.9 | Hemolytic lectin lsla |
| 6IFB-B | 16.6 | 1.8 | Lectin |
| 4PC4-C | 16.4 | 2.0 | 30k lipoprotein |
| 2IHO-A | 16.4 | 1.9 | Lectin |
References
[1] In vitro selection of phosphorothiolated aptamers.Jhaveri, S., Olwin, B., & Ellington, A. D.
Bioorganic & medicinal chemistry letters, 8(17), 2285–2290. (1998)