Mirko G Theis et.al selected and applied a specific inhibitor for ARF nucleotide-binding site opener (ARNO)/cytohesin-2[1]
Timeline
Mayer G et.al describe a general route starting with the de novo selection process targeting cytohesin-1 and aiming at the synthesis of caged aptamers[2]
Description
In 2004,Theis M.G and Knorre A had used an in Vitro Selectionan to isolate RNA aptamers with high affinity for cytohesin-2. This aptamer bound to an N-terminal segment of cytohesin-2 and did not inhibit ARF-GEF function in vitro[1].
SELEX
In 2004, Theis MG and colleagues used existing research to design the method required for the in vitro genetic-selection. Starting from a RNA pool that had a sequence of 40 random nucleotide positions, aptamers that bind specifically to cytohesin-2 were selected after 15 rounds of selection and amplification. The aptamer, K61, can bind specifically to cytohesin-2 were selected with high affinity[1].
Structure
The 2D structure of the figure is based on the article by ribodraw tool to draw[1].
5'-GGGAGAGACAAGCUUGGGUCGCGUUUUGCUAUUGAUGUUCUUUUAACCUGGCCUGUUUGGGCCUCUUGCUCUUCCUAGGAGU-3'
Ligand information
SELEX ligand
Cytohesin-2 is a protein that in humans is encoded by the CYTH2 gene. Cytohesin-2 (CYTH2), formerly known as Pleckstrin homology, Sec7 and coiled/coil domains 2 (PSCD2), is a member of the cytohesin family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of CYTHs with membranes.-----From Wiki
| Name | Uniprot ID | Pfam | MW | Amino acids sequences | PDB | Gene ID |
|---|---|---|---|---|---|---|
| Cytohesin-2 | Q99418 | PTHR10663 | 46.546 kDa | MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREELNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEELLRNLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQEQP | 1PBV | 9266 |
The aptamer bind to the affinity of the protein.
| Name | Sequence | Ligand | Affinity |
|---|---|---|---|
| K61_aptamer | 5'-GGGAGAGACAAGCUUGGGUCGCGUUUUGCUAUUGAUGUUCUUUUAACCUGGCCUGUUUGGGCCUCUUGCUCUUCCUAGGAGU-3' | cytohesin-2 | 115 ± 3 nM |
| K61_aptamer | 5'-GGGAGAGACAAGCUUGGGUCGCGUUUUGCUAUUGAUGUUCUUUUAACCUGGCCUGUUUGGGCCUCUUGCUCUUCCUAGGAGU-3' | cytohesin-1 | 4000 nM |
Similar compound
We used the Dail server website to compare the structural similarities of ligand proteins, and chose the top 10 in terms of similarity for presentation. The Dali server is a network service for comparing protein structures in 3D. Dali compares them against those in the Protein Data Bank (PDB). Z-score is a standard score that is converted from an original score. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. RMSD(Root Mean Square Deviation) value is used to measure the degree to which atoms deviate from the alignment position.
| PDB | Z-socre | RMSD | Description |
|---|---|---|---|
| 6BBP-A | 27.9 | 2.1 | Cytohesin-3, Adp-Ribosylation Factor 6 |
| 8UCQ-A | 24.7 | 1.3 | Sec7 Domain-Containing Protein |
| 7VMB-A | 22.3 | 2.1 | Iq Motif And Sec7 Domain-Containing Protein 1 |
| 1XSZ-A | 19.5 | 2.5 | Guanine Nucleotide Exchange Protein |
| 8EZJ-A | 17.2 | 2.3 | Arf Guanine-Nucleotide Exchange Factor 2 |
| 5L7S-A | 5.2 | 3.6 | Secreted Rxlr Effector Peptide Protein |
| 7V99-A | 4.4 | 4.4 | Telomerase Reverse Transcriptase |
| 7XVK-B | 4.1 | 3.9 | Serine/Threonine-Protein Phosphatase 2A 65 Kda Re |
| 8UMD-B | 4.1 | 11.3 | Flagellar M-Ring Protein |
| 4J8S-A | 4.0 | 4.4 | Ccr4-Not Transcription Complex Subunit 1 |
References
[1] Discriminatory aptamer reveals serum response element transcription regulated by cytohesin-2.Theis MG, Knorre A, Kellersch B, Moelleken J, Wieland F, Kolanus W, Famulok M.
Proc Natl Acad Sci U S A. 101(31):11221-6. (2004)
[2] From selection to caged aptamers: identification of light-dependent ssDNA aptamers targeting cytohesin.
Mayer G, Lohberger A, Butzen S, Pofahl M, Blind M, Heckel A.
Bioorg Med Chem Lett. 19(23):6561-4. (2009)
[3] RNA aptamers that modulate the RhoGEF activity of Tiam1.
Niebel B, Wosnitza CI, Famulok M.
Bioorg Med Chem. 21(20):6239-46. (2013)