Description
Sullenger, B. A. et al. reported aptamers with affinity for E2F1 in their article published in 1996. The E2F-E1 aptamer was named by Sullenger, B. A. et al. in the article[1].
SELEX
In their work published in 1996, Sullenger, B. A. Nevins et al. used SELEX to isolate RNA aptamer sequences with affinity for E2F1 from a nucleic acid library containing about 1015 sequences. Protein-RNA complexes were filtered through a wet nitrocellulose filter in a pop-top filter holder then washed using binding buffer[1].
Structure
The 2D structure of the figure is based on the article by online secondary structure prediction tool to draw. The figure shows the secondary structure prediction of the original aptamer sequence. This aptamer contains three stem loops of varying lengths. The longest stem loop has three bulge and is the main part of the aptamer[1].
5'-AGAGCGGAAGCGUGCUGGGCCAUGGAGUCGAUGUGAUAAGUAGGACGGAGGUGGUCGAUAGGGGGGAUCCAUCGACCUCUGGGUUAUG-3'
Ligand information
SELEX ligand
E2F is transcription activator that binds DNA cooperatively with docking proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DRTF1/E2F complex functions in the control of cell-cycle progression from G1 to S phase. E2F2 binds specifically to RB1 in a cell-cycle dependent manner.-----From Uniprot
UniProt ID: uniquely identifies protein sequences in the UniProt database, a resource for protein information.
Pfam: a widely recognised database of protein families and domains.
GenBank: maintained by NCBI(National Center for Biotechnology Information), is a database of nucleotide sequences from various organisms, vital for genetic and molecular biology research.
Mass: an intrinsic property of a body.
| Name | Uniprot ID | Pfam | Mass | Protein sequence | PDB ID | GenBank |
|---|---|---|---|---|---|---|
| E2F | Q14209 | PF02319 | 47.506 kDa |
......
MLQGPRALASAAGQTPKVVPAMSPTELWPSGLSSPQLCPATATYYTPLYPQTAPPAAAPGTCLDATPHGPEGQVVRCLPAGRLPAKRKLDLEGIGRPVVPEFPTPKGKCIRVDGLPSPKTPKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQLIRKKAKNNIQWVGRGMFEDPTRPGKQQQLGQELKELMNTEQALDQLIQSCSLSFKHLTEDKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRTEDNLQIYLKSTQGPIEVYLCPEEVQEPDSPSEEPLPSTSTLCPSPDSAQPSSSTDPSIMEPTASSVPAPAPTPQQAPPPPSLVPLEATDSLLELPHPLLQQTEDQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGEGISDLFDSYDLGDLLIN
|
1N4M | 1870 |
Some isolated sequences bind to the affinity of the protein[1].
| Name | Sequence | Ligand | Affinity |
|---|---|---|---|
| E2F-E1 aptamer | 5'-AGAGCGGAAGCGUGCUGGGCCAUGGAGUCGAUGUGAUAAGUAGGACGGAGGUGGUCGAUAGGGGGGAUCCAUCGACCUCUGGGUUAUG-3' | E2F protein | 4 nM |
Similar compound(s)
We used the Dail server website to compare the structural similarities of ligand proteins, and chose the top 10 in terms of similarity for presentation.
Dail server website: a network service for comparing protein structures in 3D. Dali compares them against those in the Protein Data Bank (PDB).
Z-score: a standard score that is converted from an original score. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious.
RMSD: (Root Mean Square Deviation) is used to measure the degree to which atoms deviate from the alignment position.
PDB: PDB ID+ chain name.
| PDB | Z-socre | RMSD (Å) | Description |
|---|---|---|---|
| 1N4M-A | 54.4 | 0 | Original chain |
| 4ELJ-A | 31.1 | 1.7 | Retinoblastoma-associated protein |
| 2W2H-A | 9.9 | 3.2 | Cyclin-T1 |
| 7JV7-B | 9.8 | 3.5 | CTD kinase subunit alpha |
| 7XQK-B | 9.8 | 2.8 | Glutathione S-transferase class-Mu 26 kDa isozyme |
| 6CNB-R | 9.7 | 13.2 | DNA-directed RNA polymerase III subunit RPC1 |
| 7ZS9-M | 9.5 | 19.2 | DNA-directed RNA polymerase II subunit RPB1 |
| 7KPV-B | 9.5 | 3.7 | Meiotic mRNA stability protein kinase SSN3 |
| 7NJ0-C | 9.4 | 3.3 | Securin,separin |
| 2W96-A | 9.1 | 2.9 | Cell division protein kinase 4 |
| 5IY7-M | 9.0 | 8.8 | DNA-directed RNA polymerase II subunit RPB1 |
References
[1] Inhibition of cell proliferation by an RNA ligand that selectively blocks E2F function.Ishizaki, J., Nevins, J. R., & Sullenger, B. A.
Nature medicine, 2(12), 1386–1389. (1996)