Description
O'Connell, D. et al. reported aptamers with affinity for L-selectin in their article published in 1996. The 14.12 aptamer was named by O'Connell, D. et al. in the article[1].
SELEX
In their work published in 1996, O'Connell, D. et al. used SELEX to isolate RNA aptamer sequences with affinity for L-selectin from a nucleic acid library containing about 6×1014 sequences after 6 rounds of selection process. From the seventh round, the SELEX was branched and carried in parallel at 4℃ and 22℃[1].
Structure
The 2D structure of the figure is based on the prediction results of the RNA fold website to draw. The figure shows the secondary structure prediction of the original aptamer sequence. This aptamer comprises a single stem-loop structure, with overhang sequences at both the 5' and 3' ends[1].
5'-UAACAACAAUCAAGGCGGGUUCACCGCCCCAGUAUGAGUA-3'
Ligand information
SELEX ligand
Some isolated sequences bind to the affinity of the protein[1].
| Name | Sequence | Ligand | Affinity |
|---|---|---|---|
| 14.12 aptamer | 5'-UAACAACAAUCAAGGCGGGUUCACCGCCCCAGUAUGAGUA-3' | L-selectin | 3 nM |
| 13.32 aptamer | 5'-CGCGUAUGUGUGAAAGCGUGUGCACGGAGGCGUCUACAAU-3' | L-selectin | 3 nM |
Structure ligand
L-selectin is one of calcium-dependent lectin that mediates cell adhesion by binding to glycoproteins on neighboring cells. L-selectin mediates the adherence of lymphocytes to endothelial cells of high endothelial venules in peripheral lymph nodes and promotes initial tethering and rolling of leukocytes in endothelia. Interaction with SELPLG/PSGL1 and PODXL2 is required for promoting recruitment and rolling of leukocytes. This interaction is dependent on the sialyl Lewis X glycan modification of SELPLG and PODXL2, and tyrosine sulfation modifications of SELPLG.-----From Uniprot
UniProt ID: uniquely identifies protein sequences in the UniProt database, a resource for protein information.
Pfam: a widely recognised database of protein families and domains.
GenBank: maintained by NCBI(National Center for Biotechnology Information), is a database of nucleotide sequences from various organisms, vital for genetic and molecular biology research.
Mass: an intrinsic property of a body.
| Name | Uniprot ID | Pfam | Mass | Protein sequence | PDB ID | GenBank |
|---|---|---|---|---|---|---|
| L-selectin | P14151 | IPR016348 | 42.187 kDa |
......
MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSKRSMNDPY
|
2LGF 3CFW 5VC1 |
6402 |
Similar compound(s)
We used the Dail server website to compare the structural similarities of ligand proteins, and chose the top 10 in terms of similarity for presentation.
Dail server website: a network service for comparing protein structures in 3D. Dali compares them against those in the Protein Data Bank (PDB).
Z-score: a standard score that is converted from an original score. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious.
RMSD: (Root Mean Square Deviation) is used to measure the degree to which atoms deviate from the alignment position.
PDB: PDB ID+ chain name.
| PDB | Z-socre | RMSD (Å) | Description |
|---|---|---|---|
| 3CFW-A | 30.8 | 0 | Original chain |
| 4C16-A | 21.3 | 3.5 | E-selectin |
| 2RIC-C | 16.9 | 1.6 | Pulmonary surfactant-associated protein D |
| 2VUV-A | 16.7 | 1.8 | Codakine |
| 5E4l-B | 16.2 | 6.7 | C-type mannose receptor 2 |
| 3KQG-A | 15.8 | 2.5 | C-type lectin domain family 4 member K |
| 7Y5N-A | 15.7 | 1.6 | Bone marrow proteoglycan |
| 1SL6-A | 15.6 | 3.0 | C-type lectin DC-signR |
| 6JK4-A | 15.5 | 1.9 | Type II antifreeze protein |
| 1QDD-A | 15.0 | 2.0 | Lithostathine |
| 3L9J-C | 15.0 | 2.2 | Tnfalpha |
References
[1] Calcium-dependent oligonucleotide antagonists specific for L-selectin.O'Connell, D., Koenig, A., Jennings, S., Hicke, B., Han, H. L., Fitzwater, T., Chang, Y. F., Varki, N., Parma, D., & Varki, A.
Proceedings of the National Academy of Sciences of the United States of America, 93(12), 5883–5887. (1996)